Learn More
enQuireBio™ Recombinant Human PRL R Protein
A cDNA sequence encoding the PRL R was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP10846-5ug
Informations supplémentaires : Poids : 0.01000kg
Spécification
PRL R Protein | |
5 μg | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW |
Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions. | |
Research Use Only | |
Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio. | |
Human | |
Untagged | |
The Prolactin Receptor was lyophilized from a concentrated (0.4 mg/ml) solution with 0.0045mM NaHCO3. |