missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Ag85B Protein

A cDNA sequence encoding the Ag85B was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP10977-2ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15915758

  • 137.00€ / 2µg
Expédition estimée: 23-06-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

885785
Greater than 90.0% as determined by SDS-PAGE.
Research Use Only
fbpB
Other
His
Lyophilized with 0.1% glycerol.
Ag85B Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Vidéos
FDS
Documents
Certificats
Promotions

Promotions