missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Der P1 Protein

A cDNA sequence encoding the Der P1 was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP11657-100ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15947938

  • 205.00€ / 100µg
Expédition estimée: 10-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

Der P1 Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY VVILHHHHHH
Protein is >95% pure as determined by 10% SDS-PAGE (coomassie staining).
Research Use Only
DERP1
Other
His
(1 mg/ml) 60mM NaCl, 50mM Tris-HCl pH 8.0 and 1.2M Urea.
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions