missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rabbit GHBP Protein
A cDNA sequence encoding the GHBP was constructed and used to recombinantly synthesize the protein.
131.00€ - 4880.00€
Spécification
Nom | GHBP Protein |
---|---|
État réglementaire | Research Use Only |
Concentration en endotoxines | < 1.0 EU per ug protein as determined by the LAL method. |
Activité biologique | Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones. |
Type de produit | Recombinant Protein |
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
15964498
|
enQuireBio™
QP10642-5UG |
5 μg |
131.00€
5µg |
Expédition estimée: 07-06-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
15954498
|
enQuireBio™
QP10642-20UG |
20 μg |
203.00€
20µg |
Expédition estimée: 07-06-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
15944498
|
enQuireBio™
QP10642-1MG |
1 mg |
4880.00€
1mg |
Expédition estimée: 07-06-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Spécification
GHBP Protein | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP | |
Greater than 98.0% as determined bySDS-PAGE. |
Research Use Only | |
Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones. | |
Rabbit | |
Untagged | |
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3. |