missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit IL 8 Protein

A cDNA sequence encoding the IL 8 was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP12400-25ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15950299

  • 181.00€ / 25µg
Expédition estimée: 08-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

100009129
Greater than 90% as determined by SDS-PAGE.
Research Use Only
CXCL8
Rabbit
His
The IL-8 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
IL 8 Protein
25 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions