enQuireBio™ Recombinant Rabbit IL 8 Protein

Name: enQuireBio&trade; Recombinant Rabbit IL 8 Protein
Brand: enQuireBio&trade;
SKU: 15950299
Price: 203.00 EUR

A cDNA sequence encoding the IL 8 was constructed and used to recombinantly synthesize the protein.

Marque: enQuireBio™ QP12400-25ug

Informations supplémentaires : Poids : 0.01000kg

Code produit. 15950299

Expédition estimée: 31-05-2024
pour voir le stock disponible

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Spécification

Identification génétique (Entrez)	100009129
Quantité	25 μg
Concentration en endotoxines	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Type de produit	Recombinant Protein
Espèces	E. coli
Séquence	AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES
Pureté ou qualité	Greater than 90% as determined by SDS-PAGE.

Nom	IL 8 Protein
État réglementaire	Research Use Only
Symbole de gène(s)	CXCL8
Réactivité croisée	Rabbit
Marqueur de protéine	His
Tampon	The IL-8 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.

Suggestions de produits

Description