missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat CNTF Protein

A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.

137.00€ - 4060.00€

Spécification

Nom CNTF Protein
Type de produit Recombinant Protein
Marqueur de protéine Untagged
Espèces hôtes E. coli
Réactivité croisée Rat
Consulter d'autres spécifications

Produits 3
Code produit Marque Quantité Prix Quantité et disponibilité  
Code produit Marque Quantité Prix Quantité et disponibilité  
15934248
Afficher les documents Détails de la promotion
enQuireBio™
QP10559-5UG
5 μg
137.00€
5µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 04-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
15924248
Afficher les documents Détails de la promotion
enQuireBio™
QP10559-25UG
25 μg
205.00€
25µg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 04-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
15914248
Afficher les documents Détails de la promotion
enQuireBio™
QP10559-1MG
1 mg
4060.00€
1mg
Voir les produits de remplacement
Économisez jusqu'à 
»
Expédition estimée: 04-08-2022
pour voir le stock disponible 
Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!
Description

Description

Spécification

Spécification

CNTF Protein
Untagged
Rat
Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Recombinant Protein
E. coli
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
FDS
Product Certifications