missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat Tpc1808 Protein

A cDNA sequence encoding the Tpc1808 was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP13791-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15924719

  • 2710.00€ / 1mg
Expédition estimée: 04-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

Tpc1808 Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Vidéos
FDS
Documents
Certificats
Promotions

Promotions