missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rat Tpc1808 Protein
A cDNA sequence encoding the Tpc1808 was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP13791-1mg
Informations supplémentaires : Poids : 0.01000kg
Spécification
Tpc1808 Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS | |
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
1 mg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Rat | |
His | |
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4. |