missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant West Nile Virus WNV Pre-M Protein

A cDNA sequence encoding the WNV Pre-M was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP13965-100ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15955259

  • 205.00€ / 100µg
Expédition estimée: 14-03-2023
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

West Nile Virus WNV Pre-M Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
West Nile Virus
His
20mM phosphate buffer pH 7.5.
Protein is >95% pure as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions