missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SYT1 Recombinant Protein

Marque:  Abnova™ H00006857-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16151162

  • 545.00€ / 25µg
Expédition estimée: 19-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Spécification

AAH58917
Solution
6857
SYT1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SYT1
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
72.16
8
Glutathione Sepharose 4 Fast Flow
25 ug
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
DKFZp781D2042/P65/SVP65/SYT
SYT1
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions