missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ TFPI Recombinant Protein

Human TFPI full-length ORF recombinant protein with GST-tag at N-terminal

Marque:  Abnova™ H00007035-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16151352

  • 545.00€ / 25µg
Expédition estimée: 13-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

This gene encodes a protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. The encoded protein is glycosylated and predominantly found in the vascular endothelium and plasma in both free forms and complexed with plasma lipoproteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been confirmed.

  • Molecular Weight: 53.35kDa
  • Preparation Method: in vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 Fast Flow
  • Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8.0 in the elution buffer

Sequence: MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGT
QLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFCIHASMFFLGLDSISCLC

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Spécification

AAH15514
Solution
7035
TFPI (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TFPI
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
53.35
8
Glutathione Sepharose 4 Fast Flow
25 ug
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFCIHASMFFLGLDSISCLC
EPI/LACI/TFI/TFPI1
TFPI
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions