missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 16166686

TUBE1, Rabbit anti-Human, Polyclonal Antibody, Abnova™

Code produit 16166686
Change view
Click to view available options
Quantité:
100 μg
Conditionnement:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
16166686 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16166686 Fournisseur Abnova Code fournisseur H00051175D01P.100ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

Sequence: MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIAM

Spécification

Antigène TUBE1
Applications Western Blot
Classification Polyclonal
Conjugué Unconjugated
Formule In 1x PBS, pH 7.4
Expression tubulin, epsilon 1
Numéro d’ordre du gène NM_016262
Alias de gène FLJ22589/TUBE/dJ142L7.2
Symboles de gène(s) TUBE1
Espèces hôtes Rabbit
Immunogène TUBE1 (NP_057346.1, 1 a.a. ∼ 475 a.a) full-length human protein.
Quantité 100 μg
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 51175
Espèces cibles Human
Contenu et stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Type de produit Antibody
Forme Purified
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.