missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF81 Rabbit anti-Human, Polyclonal , Abnova™
Description
Sequence: VHPSPNLILSQKRPHKRDSFGKSFKHNLDLHIHNKSNAAKNLDKTIGHGQVFTQNSSYSHHENTHTGVKFCERNQCGKVLSLKHSLSQNVKFPIGEKANTCT
Spécification
Spécification
| Antigène | ZNF81 |
| Applications | Immunofluorescence, Immunohistochemistry (PFA fixed) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Description | Rabbit polyclonal antibody raised against recombinant human ZNF81. |
| Dilution | Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
| Formule | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Alias de gène | FLJ44367/HFZ20/MRX45 |
| Symboles de gène(s) | ZNF81 |
| Espèces hôtes | Rabbit |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?