missing translation for 'onlineSavingsMsg'
Learn More

CYP3A7 Antibody, Novus Biologicals™

Code produit 18535250 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μg
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18535250 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18535250 Fournisseur Novus Biologicals Code fournisseur NBP162676

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

CYP3A7 Polyclonal antibody specifically detects CYP3A7 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigène CYP3A7
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugué Unconjugated
Dilution Western Blot 1.0 μg/mL
Formule PBS, 2% Sucrose
Numéro d’ordre du gène P24462
Alias de gène CYPIIIA7, cytochrome P450, family 3, subfamily A, polypeptide 7, Cytochrome P450-HFLA, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, subfamily IIIA, polypeptide 7, xenobiotic monooxygenase
Espèces hôtes Rabbit
Immunogène Synthetic peptides corresponding to CYP3A7(cytochrome P450, family 3, subfamily A, polypeptide 7) The peptide sequence was selected form the middle region of CYP3A7. Peptide sequence KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG. The peptide sequence for this immunogen was taken from within the described region.
Méthode de purification Affinity purified
Quantité 100 μg
État réglementaire RUO
Disciplines de recherche Lipid and Metabolism
Primaire ou secondaire Primary
Identification génétique (Entrez) 1551
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.