missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Calmodulin Polyclonal antibody specifically detects Calmodulin in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigène | Calmodulin |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugué | PE |
| Formule | PBS |
| Alias de gène | CALM, CALM2, CALM3, CALML2, calmodulin, calmodulin 1 (phosphorylase kinase, delta), CaM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMI, CAMIII, DD132, PHKDCAM, phosphorylase kinase, delta subunit |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (NP_008819.1).,, Sequence:, LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?