missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MCART1 Polyclonal antibody specifically detects MCART1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Spécification
Spécification
| Antigène | MCART1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugué | FITC |
| Formule | PBS |
| Alias de gène | CG7943, FLJ37273, MGC14836, mitochondrial carrier triple repeat 1, mitochondrial carrier triple repeat protein 1 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCART1 (NP_219480.1).,, Sequence:, MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFG |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?