missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Caspase-4 Antibody [DyLight 405], Novus Biologicals Biologicals™
Tous les produits Bio Techne ProduitsDescription
Caspase-4 Polyclonal antibody specifically detects Caspase-4 in Human samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Spécification
Spécification
| Antigène | Caspase-4 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | DyLight 405 |
| Formule | 50mM Sodium Borate |
| Alias de gène | apoptotic cysteine protease Mih1/TX, CASP-4, caspase 4, apoptosis-related cysteine peptidase, caspase 4, apoptosis-related cysteine protease, caspase-4, EC 3.4.22, EC 3.4.22.57, ICE(rel)II, ICE(rel)-II, ICEREL-II, ICH2, ICH-2, Mih1/TX, Protease ICH-2, Protease TX, TX |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 81-270 of human Caspase-4 (NP_001216.1).,, Sequence:, SDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?