missing translation for 'onlineSavingsMsg'
Learn More

Adenylate Cyclase 8 Antibody, Novus Biologicals™

Code produit 18421302 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18421302 25 μL 25µL
18220468 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18421302 Fournisseur Novus Biologicals Code fournisseur NBP19027825ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

Adenylate Cyclase 8 Polyclonal specifically detects Adenylate Cyclase 8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène Adenylate Cyclase 8
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène AC8, ADCY3, adenylate cyclase 8 (brain), adenylate cyclase type 8, Adenylate cyclase type VIII, Adenylyl cyclase 8, adenylyl cyclase-8, brain, ATP pyrophosphate-lyase 8, Ca(2+)/calmodulin-activated adenylyl cyclase, EC 4.6.1.1, HBAC1
Symboles de gène(s) ADCY8
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF
Méthode de purification Affinity Purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Lipid and Metabolism
Primaire ou secondaire Primary
Identification génétique (Entrez) 114
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.