Afadin/AF-6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP1-90220-25ul

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Code produit. 18474242

415.00€ / 25µL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Afadin/AF-6 Polyclonal specifically detects Afadin/AF-6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spécification

Antigène	Afadin/AF-6
Classification	Polyclonal
Dilution	Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Alias de gène	AF64, afadin, FLJ34371, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 4
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Identification génétique (Entrez)	4301
Espèces cibles	Human
Isotype	IgG

Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugué	Unconjugated
Formule	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Symboles de gène(s)	MLLT4
Immunogène	This antibody was developed against Recombinant Protein corresponding to amino acids:EAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADE
Quantité	25 μL
Primaire ou secondaire	Primary
Spécificité du test	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenu et stockage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Afadin/AF-6 Antibody, Novus Biologicals™

Description

Spécification

Product Suggestions

Documents

Promotions