missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AKIP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP1-90202
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
AKIP Polyclonal specifically detects AKIP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
| AKIP | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9NWT8 | |
| AURKAIP1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 54998 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AIPAKIPaurora kinase A-interacting protein, AURKA-interacting protein, aurora kinase A interacting protein 1, aurora-A kinase interacting protein, FLJ20608 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu