AKIP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP1-90202-25ul

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Artikelnummer. 18408561

292.00€ / 25µL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

AKIP Polyclonal specifically detects AKIP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spezifikation

Antigène	AKIP
Classification	Polyclonal
Dilution	Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Numéro d’ordre du gène	Q9NWT8
Symboles de gène(s)	AURKAIP1
Immunogène	This antibody was developed against Recombinant Protein corresponding to amino acids:KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR
Quantité	25 μL
Disciplines de recherche	Cell Cycle and Replication
Identification génétique (Entrez)	54998
Espèces cibles	Human
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugué	Unconjugated
Formule	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène	AIPAKIPaurora kinase A-interacting protein, AURKA-interacting protein, aurora kinase A interacting protein 1, aurora-A kinase interacting protein, FLJ20608
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Primaire ou secondaire	Primary
Spécificité du test	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenu et stockage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

AKIP Antibody, Novus Biologicals™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen