missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APOBEC3D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-49168-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
APOBEC3D Polyclonal antibody specifically detects APOBEC3D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
| APOBEC3D | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| APOBEC3DE, APOBEC3E, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative), apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene, ARP6, DNA dC->dU-editing enzyme APOBEC-3D, EC 3.5.4, EC 3.5.4.-, probable DNA dC->dU-editing enzyme APOBEC-3D | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VFRGPVLPKRQSNHRQEVYFRFENHAEMCF | |
| 25 μL | |
| Cell Biology | |
| 140564 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu