missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
AZ1 Polyclonal antibody specifically detects AZ1 in Human, Mouse samples. It is validated for Western Blot
Spécification
Spécification
| Antigène | AZ1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formule | PBS with 50% glycerol, pH7.3. |
| Alias de gène | 5-azacytidine induced 1, 5-azacytidine-induced protein 1, AZ1, centrosomal protein 131 kDa, centrosomal protein of 131 kDa, Cep131, KIAA1118, pre-acrosome localization protein 1, ZA1 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 1000-1083 of human AZ1 (NP_001306157.1). IRQEFEDRLAASEEETRQAKAELATLQARQQLELEEVHRRVKTALARKEEAVSSLRTQHEAAVKRADHLEELLEQHRRPTPSTK |
| Méthode de purification | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?