missing translation for 'onlineSavingsMsg'
Learn More
Learn More
beta-1 Adrenergic R/ADRB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP1-59007-100ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
beta-1 Adrenergic R/ADRB1 Polyclonal antibody specifically detects beta-1 Adrenergic R/ADRB1 in Human, Mouse, Rat samples. It is validated for Western Blot
Spécification
| beta-1 Adrenergic R/ADRB1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| ADRB1RRHR, adrenergic, beta-1-, receptor, B1AR, beta-1 adrenergic receptor, Beta-1 adrenoceptor, Beta-1 adrenoreceptor, BETA1AR | |
| Synthetic peptides corresponding to ADRB1(adrenergic, beta-1-, receptor) The peptide sequence was selected from the middle region of ADRB1. Peptide sequence CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| GPCR, Neuroscience | |
| 153 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL | |
| P08588 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu