missing translation for 'onlineSavingsMsg'
Learn More
Learn More
beta Casein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP1-88188-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
beta Casein Polyclonal specifically detects beta Casein in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| beta Casein | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| beta-casein, CASB, casein beta | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 1447 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CSN2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVH | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction