missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BID (Human) Recombinant Protein

Human BID full-length ORF ( AAH09197, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00000637-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16152241

  • 545.00€ / 25µg
Expédition estimée: 18-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Spécification

Spécification

AAH09197
BH3 interacting domain death agonist
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BID
GST
637
Wheat germ expression system
25 μg
FP497, MGC15319, MGC42355
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents
Certificats
Promotions

Promotions