missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
BOLA2 Polyclonal specifically detects BOLA2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
Spécification
| Antigène | BOLA2 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formule | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias de gène | BolA Homolog 2B (E. Coli), BOLA2, BOLA2A, BOLA2B, BolA-Like 2B, BolA-Like 2B (E. Coli), BolA-Like Protein 2, BolA-Like Protein 2 Member B, BolA-Like Protein 2B |
| Symboles de gène(s) | BOLA2B |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against a Recombinant Protein corresponding to amino acids:LEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRD |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?