missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. BOLA2 Antibody, Novus Biologicals™

BOLA2 Antibody, Novus Biologicals™

Code produit 18675837 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
25 μL
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18675837 25 μL 25µL
18249290 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18675837 Fournisseur Novus Biologicals Code fournisseur NBP25472025ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

BOLA2 Polyclonal specifically detects BOLA2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène BOLA2
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry-Paraffin 1:20 - 1:50
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène BolA Homolog 2B (E. Coli), BOLA2, BOLA2A, BOLA2B, BolA-Like 2B, BolA-Like 2B (E. Coli), BolA-Like Protein 2, BolA-Like Protein 2 Member B, BolA-Like Protein 2B
Symboles de gène(s) BOLA2B
Espèces hôtes Rabbit
Immunogène This antibody was developed against a Recombinant Protein corresponding to amino acids:LEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRD
Méthode de purification Immunogen affinity purified
Quantité 25 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 654483
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles.
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.