missing translation for 'onlineSavingsMsg'
Learn More

Cadherin-7 Antibody, Novus Biologicals™

Code produit 18689836 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18689836 0.1 mL 0.10mL
18635016 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18689836 Fournisseur Novus Biologicals Code fournisseur NBP249330

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

Cadherin-7 Polyclonal antibody specifically detects Cadherin-7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène Cadherin-7
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formule PBS (pH 7.2), 40% Glycerol
Alias de gène cadherin 7, type 2, cadherin-7, CDH7L1
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: FDMAALRNLNVIRDTKTRRDVTPEIQFLSRPAFKSIPDNVIFREFIWERLKEADVDP
Méthode de purification Immunogen affinity purified
Quantité 0.1 mL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 1005
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.