missing translation for 'onlineSavingsMsg'
Learn More

CAPZB Antibody (1H1), Novus Biologicals™

Code produit 18328267 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mg
Conditionnement:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18328267 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18328267 Fournisseur Novus Biologicals Code fournisseur H00000832M02

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Mouse Monoclonal Antibody

CAPZB Monoclonal antibody specifically detects CAPZB in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA
TRUSTED_SUSTAINABILITY

Spécification

Antigène CAPZB
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
Classification Monoclonal
Clone 1H1
Conjugué Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA
Formule In 1x PBS, pH 7.4
Numéro d’ordre du gène NP_004921
Alias de gène Cap Z, CAPB, CAPPB, capping protein (actin filament) muscle Z-line, beta, CAPZ, CapZ beta, F-actin capping protein beta subunit, F-actin-capping protein subunit beta, MGC104401, MGC129749, MGC129750
Espèces hôtes Mouse
Immunogène CAPZB (NP_004921, 192 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
Méthode de purification IgG purified
Quantité 0.1 mg
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 832
Espèces cibles Human
Contenu et stockage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG2a κ
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.