missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Casein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-55090-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Casein Polyclonal specifically detects Casein in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| Casein | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| alpha, alpha-S1-casein, CASA, casein alpha s1, MGC149368 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 1446 | |
| Human | |
| IgG |
| Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CSN1S1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSD | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu