missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. Cav1.4 Antibody, Novus Biologicals™

Cav1.4 Antibody, Novus Biologicals™

Code produit 18672567 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μg
25 μL
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18672567 25 μL 25µL
18619897 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18672567 Fournisseur Novus Biologicals Code fournisseur NBP26886925ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

Cav1.4 Polyclonal antibody specifically detects Cav1.4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène Cav1.4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formule PBS (pH 7.2) and 40% Glycerol
Alias de gène AIED, CACNAF1, calcium channel, voltage-dependent, L type, alpha 1F subunit, Cav1.4, Cav1.4alpha1, COD4, CORDX, CORDX3CSNB2, CSNB2AAland island eye disease (Forsius-Eriksson ocular albinism, ocular albinismtype 2), CSNBX2, JM8, JMC8, OA2COD3, voltage-dependent L-type calcium channel subunit alpha-1F, Voltage-gated calcium channel subunit alpha Cav1.4
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH
Méthode de purification Protein A purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Neuronal Cell Markers, Neurotransmission, Vision
Primaire ou secondaire Primary
Identification génétique (Entrez) 778
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.