missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 30498187

CBFA2T3 Antibody [DyLight 594], Novus Biologicals Biologicals™

Code produit 30498187 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité
30498187 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30498187 Fournisseur Novus Biologicals Code fournisseur NBP335460DL594
 Article restreint
Expédition estimée: 17-09-2026
Ajouter au panier
Ajouter au panier
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

CBFA2T3 Polyclonal antibody specifically detects CBFA2T3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigène CBFA2T3
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué DyLight 594
Formule 50mM Sodium Borate
Alias de gène core-binding factor, runt domain, alpha subunit 2; translocated to, 3, hMTG16, MTG16ETO2, MTG8-related protein 2, MTGR2MTG8-related gene 2, Myeloid translocation gene on chromosome 16 protein, protein CBFA2T3, Zinc finger MYND domain-containing protein 4, ZMYND4myeloid translocation gene 8 and 16b
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 593-653 of human CBFA2T3 (NP_005178.4).,, Sequence:, DRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTER
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 863
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.