missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCL4/MIP-1 beta Antibody - Azide and BSA Free, Novus Biologicals™
Tous les produits Bio Techne ProduitsDescription
CCL4/MIP-1 beta Polyclonal antibody specifically detects CCL4/MIP-1 beta in Rat samples. It is validated for Western Blot
Spécification
Spécification
| Antigène | CCL4/MIP-1 beta |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000 |
| Formule | PBS with 50% glycerol, pH7.3. |
| Alias de gène | ACT2, ACT-2, AT744.1, C-C motif chemokine 4, chemokine (C-C motif) ligand 4, G-26, G-26 T-lymphocyte-secreted protein, HC21, LAG1, LAG-1, Lymphocyte activation gene 1 protein, Macrophage inflammatory protein 1-beta, MIP1B, MIP1B1, MIP-1-beta, MIP-1-beta(1-69), PAT 744, Protein H400, SCYA2, SCYA4, secreted protein G-26, SIS-gamma, small inducible cytokine A4 (homologous to mouse Mip-1b), Small-inducible cytokine A4, T-cell activation protein 2 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 1-92 of human CCL4/MIP-1 beta (NP_002975.1). MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
| Méthode de purification | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?