missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD300a/LMIR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
222.00€ - 539.00€
Spécification
| Antigène | CD300a/LMIR1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18439890
|
Novus Biologicals
NBP1-84431-25ul |
25 μL |
222.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18751704
|
Novus Biologicals
NBP1-84431 |
539.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||||
Description
CD300a/LMIR1 Polyclonal specifically detects CD300a/LMIR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spécification
| CD300a/LMIR1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CD300a antigenCMRF35H9, CD300a molecule, CLM-8, CMRF-35H, CMRF35-H, CMRF35H leukocyte immunoglobulin-like receptor, CMRF35-H9, CMRF-35-H9CD300 antigen-like family member A, CMRF35HIRp60, CMRF35-like molecule 8, IgSF12, IGSF12NK inhibitory receptor, Immunoglobulin superfamily member 12, Inhibitory receptor protein 60, IRC1, IRC1/IRC2, IRC2, Irp60, leukocyte membrane antigen | |
| CD300A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Mast Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 11314 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit