missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD34 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
294.00€ - 523.00€
Spécification
| Antigène | CD34 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18067733
|
Novus Biologicals
NBP2-38321 |
0.1 mL |
523.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18655375
|
Novus Biologicals
NBP2-38321-25ul |
25 μL |
294.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
CD34 Polyclonal specifically detects CD34 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spécification
| CD34 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P28906 | |
| 947 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Angiogenesis, B Cell Development and Differentiation Markers, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Hypoxia, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Myeloid Cell Markers, Myeloid derived Suppressor Cell, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD34 antigenhematopoietic progenitor cell antigen CD34, CD34 molecule | |
| CD34 | |
| IgG | |
| Affinity Purified |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit