Abnova™ CD48 (Human) Recombinant Protein

Name: Abnova&trade; CD48 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16152891
Price: 508.00 EUR

Human CD48 full-length ORF ( AAH16182, 30 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.

Marque: Abnova™ H00000962-P02.25ug

Informations supplémentaires : Poids : 0.00010kg

Code produit. 16152891

Expédition estimée: 31-05-2024
pour voir le stock disponible

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

Sequence: LVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT

Spécification

Numéro d’adhésion	AAH16182
Nom	CD48 molecule
Test du contrôle qualité	125% SDS-PAGE Stained with Coomassie Blue
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Symbole de gène(s)	CD48
Marqueur de protéine	GST

Identification génétique (Entrez)	962
Méthode de préparation	Wheat germ expression system
Quantité	25 μg
Alias de gène	BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48
Espèces	Wheat Germ (in vitro)
Tampon	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Suggestions de produits

Description