missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CD48 (Human) Recombinant Protein

Human CD48 full-length ORF ( AAH16182, 30 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00000962-P02.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16152891

  • 545.00€ / 25µg
Expédition estimée: 04-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: LVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Spécification

Spécification

AAH16182
CD48 molecule
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD48
GST
962
Wheat germ expression system
25 μg
BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents
Certificats
Promotions

Promotions