missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP1-85894-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
CDS1 Polyclonal specifically detects CDS1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
| CDS1 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| CDP-DAG synthase 1, CDP-DG synthase 1, CDP-DG synthetase 1, CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1, CDP-diacylglycerol synthase 1, CDP-diglyceride pyrophosphorylase 1, CDP-diglyceride synthase 1, CDP-diglyceride synthetase 1, CDS, CDS 1, CTP:phosphatidate cytidylyltransferase 1, EC 2.7.7.41, phosphatidate cytidylyltransferase 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CDS1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQ | |
| 25 μL | |
| Lipid and Metabolism | |
| 1040 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu