missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CHFR Polyclonal antibody specifically detects CHFR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
Spécification
| Antigène | CHFR |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formule | PBS (pH 7.2) and 40% Glycerol |
| Alias de gène | checkpoint with forkhead and ring finger domains, Checkpoint with forkhead and RING finger domains protein, E3 ubiquitin-protein ligase CHFR, EC 6.3.2.-, FLJ10796, FLJ33629, RING finger protein 196, RNF196RNF116 |
| Espèces hôtes | Rabbit |
| Immunogène | This antibody was developed against a recombinant protein corresponding to amino acids: AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR |
| Méthode de purification | Protein A purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?