missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-92171-0.1ml
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Cholecystokinin-B R/CCKBR Polyclonal antibody specifically detects Cholecystokinin-B R/CCKBR in Human, Mouse, Rat samples. It is validated for Western Blot
Spécification
| Cholecystokinin-B R/CCKBR | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| CCK2 receptor, CCK2R, CCK2-R, CCK-B, CCK-B receptor, CCK-BR, CCKRB, cholecystokinin B receptor, Cholecystokinin-2 receptor, cholecystokinin-B receptor/gastrin receptor, GASR, gastrin receptor, gastrin/cholecystokinin type B receptor | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 240-335 of human CCKBR (NP_795344.1). LISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRML | |
| 0.1 mL | |
| Cell Cycle and Replication, GPCR, Signal Transduction | |
| 887 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu