missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. CIB3 Antibody, Novus Biologicals™

CIB3 Antibody, Novus Biologicals™

Code produit 18276593 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18276593 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18276593 Fournisseur Novus Biologicals Code fournisseur NBP155314

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

CIB3 Polyclonal specifically detects CIB3 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène CIB3
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène Q96Q77
Alias de gène calcium and integrin binding family member 3, calcium and integrin-binding family member 3, DNA-dependent protein kinase catalytic subunit-interacting protein 3, Kinase-interacting protein 3, KIP 3, KIP3MGC96922, MGC138405, MGC142151
Symboles de gène(s) CIB3
Espèces hôtes Rabbit
Immunogène Synthetic peptides corresponding to CIB3(calcium and integrin binding family member 3) The peptide sequence was selected from the N terminal of CIB3. Peptide sequence QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG.
Poids moléculaire de l’antigène 22 kDa
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 117286
Spécificité du test Guinea pig: 86%; Equine: 75%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.