missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CKII alpha prime polypeptide Antibody [DyLight 488], Novus Biologicals Biologicals™
Tous les produits Bio Techne ProduitsDescription
CKII alpha prime polypeptide Polyclonal antibody specifically detects CKII alpha prime polypeptide in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Spécification
Spécification
| Antigène | CKII alpha prime polypeptide |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | DyLight 488 |
| Formule | 50mM Sodium Borate |
| Alias de gène | casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CKII alpha prime polypeptide (NP_001887.1).,, Sequence:, LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?