missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Claudin-5 Antibody (3D8), Novus Biologicals™
Mouse Monoclonal Antibody
Marque: Novus Biologicals H00007122-M01
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Claudin-5 Monoclonal antibody specifically detects Claudin-5 in Human samples. It is validated for ELISA, ELISA
Spécification
| Claudin-5 | |
| Monoclonal | |
| Unconjugated | |
| NP_003268 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| ELISA, Sandwich ELISA | |
| 3D8 | |
| In 1x PBS, pH 7.4 | |
| AWALTransmembrane protein deleted in VCFS, BEC1, claudin 5, claudin-5, CPETRL1, TMVCFTMDVCF, transmembrane protein deleted in velocardiofacial syndrome | |
| CLDN5 (NP_003268, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR | |
| 0.1 mg | |
| Cellular Markers | |
| 7122 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2b κ |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu