missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COPG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marque: Novus Biologicals NBP2-55178-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
COPG Polyclonal specifically detects COPG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
| COPG | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| coat protein gamma-cop, coatomer protein complex, subunit gamma, coatomer protein complex, subunit gamma 1, COPG1coatomer subunit gamma, FLJ21068, Gamma-coat protein, gamma-COP | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| COPG1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL | |
| 25 μL | |
| Signal Transduction | |
| 22820 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu