missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. CORO1B Antibody, Novus Biologicals™

CORO1B Antibody, Novus Biologicals™

Code produit 18682488 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
25 μL
0.1 mL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18682488 25 μL 25µL
18619666 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18682488 Fournisseur Novus Biologicals Code fournisseur NBP24963425ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

CORO1B Polyclonal antibody specifically detects CORO1B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène CORO1B
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 1:100 - 1:250, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formule PBS (pH 7.2), 40% Glycerol
Alias de gène coronin, actin binding protein, 1B, coronin, actin-binding protein, 1B, coronin-1B, coronin-2, DKFZp762I166
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD
Méthode de purification Immunogen affinity purified
Quantité 25 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 57175
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.