missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Creatine kinase MT 1B Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP3-05655-100ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Creatine kinase MT 1B Polyclonal antibody specifically detects Creatine kinase MT 1B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Spécification
| Creatine kinase MT 1B | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:100, Immunoprecipitation 1:500 - 1:1000 | |
| Acidic-Type Mitochondrial Creatine Kinase, CKMT, CKMT1, CKMT1B, Creatine Kinase U-Type, Mitochondrial, Creatine Kinase, Mitochondrial 1 (Ubiquitous), Creatine Kinase, Mitochondrial 1B, EC 2.7.3.2, Mia-CK, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, UMTCK | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human Creatine kinase MT 1B (NP_066270.1). MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT | |
| 100 μg | |
| Stem Cell Markers | |
| 1159 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence, Immunoprecipitation | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu