missing translation for 'onlineSavingsMsg'
Learn More

CRMP1 Antibody [Alexa Fluor« 647], Novus Biologicals Biologicals™

Code produit 30498638 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
Conditionnement:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30498638 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498638 Leverandør Novus Biologicals Leverandørnr. NBP338009AF647

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Rabbit Polyclonal Antibody

CRMP1 Polyclonal antibody specifically detects CRMP1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigène CRMP1
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugué Alexa Fluor 647
Formule 50mM Sodium Borate
Alias de gène collapsin response mediator protein 1DRP1, CRMP-1, dihydropyrimidinase-like 1, dihydropyrimidinase-related protein 1, DPYSL1DRP-1dihydropyrimidinase related protein-1, ULIP3, ULIP-3, Unc-33-like phosphoprotein 3
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 460-540 of human CRMP1 (NP_001304.1).,, Sequence:, NVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFS
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Neuroscience
Primaire ou secondaire Primary
Identification génétique (Entrez) 1400
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.