missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CRTAP Monoclonal antibody specifically detects CRTAP in Human samples. It is validated for Western Blot, ELISA
Spécification
Spécification
| Antigène | CRTAP |
| Applications | Western Blot, ELISA |
| Classification | Monoclonal |
| Clone | 2G5 |
| Conjugué | Unconjugated |
| Formule | In 1x PBS, pH 7.4 |
| Numéro d’ordre du gène | NP_006362 |
| Alias de gène | cartilage associated protein, cartilage-associated protein, CASPLEPREL3, leprecan-like 3 |
| Espèces hôtes | Mouse |
| Immunogène | CRTAP (NP_006362, 307 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?