missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CYP4F2 Polyclonal antibody specifically detects CYP4F2 in Human samples. It is validated for Western Blot
Spécification
Spécification
| Antigène | CYP4F2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formule | PBS with 50% glycerol, pH7.3. |
| Alias de gène | CPF2, CYPIVF2, Cytochrome P450 4F2, cytochrome P450, family 4, subfamily F, polypeptide 2, cytochrome P450, subfamily IVF, polypeptide 2, Cytochrome P450-LTB-omega, EC 1.14.13.30, leukotriene B4 omega-hydroxylase, Leukotriene-B(4) 20-monooxygenase 1, leukotriene-B(4) omega-hydroxylase 1, leukotriene-B4 20-monooxygenase |
| Espèces hôtes | Rabbit |
| Immunogène | Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human CYP4F2 (NP_001073.3). AFYDNCRRLRCFPQPPRRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPK |
| Méthode de purification | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?