missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. Cysteinyl Leukotriene R2/CysLTR2 Antibody, Novus Biologicals™

Cysteinyl Leukotriene R2/CysLTR2 Antibody, Novus Biologicals™

Code produit 18487781 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18487781 0.1 mL 0.10mL
18484512 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18487781 Fournisseur Novus Biologicals Code fournisseur NBP213897

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

Cysteinyl Leukotriene R2/CysLTR2 Polyclonal antibody specifically detects Cysteinyl Leukotriene R2/CysLTR2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène Cysteinyl Leukotriene R2/CysLTR2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formule PBS (pH 7.2) and 40% Glycerol
Alias de gène CysLT(2), CYSLT2KPG_011, CYSLT2RHG57, CysLTR2, cysteinyl leukotriene CysLT2 receptor, cysteinyl leukotriene receptor 2, G protein-coupled receptor, G-protein coupled receptor GPCR21, G-protein coupled receptor HG57, hGPCR21, HPN321
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE
Méthode de purification Immunogen affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche GPCR
Primaire ou secondaire Primary
Identification génétique (Entrez) 57105
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.