DAK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP2-48894

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Product Code. 18664536

624.00€ / 0.10mL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

This item is not returnable. View return policy

Description

DAK Polyclonal antibody specifically detects DAK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigène	DAK
Classification	Polyclonal
Dilution	Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Alias de gène	ATP-dependent dihydroxyacetone kinase, bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing), DHA kinase, Dha kinase/FMN cyclase, dihydroxyacetone kinase 2 homolog (S. cerevisiae), dihydroxyacetone kinase 2 homolog (yeast), DKFZp586B1621, FAD-AMP lyase cyclic FMN forming, FAD-AMP lyase cyclizing, glycerone kinase, MGC5621, NET45
Immunogène	This antibody was developed against a recombinant protein corresponding to amino acids: PGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAIL
Quantité	0.1 mL
Disciplines de recherche	Lipid and Metabolism
Identification génétique (Entrez)	26007
Contenu et stockage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugué	Unconjugated
Formule	PBS (pH 7.2), 40% Glycerol
Espèces hôtes	Rabbit
Méthode de purification	Immunogen affinity purified
État réglementaire	RUO
Primaire ou secondaire	Primary
Espèces cibles	Human
Forme	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

DAK Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions